PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504089.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 595aa    MW: 68787.2 Da    PI: 8.0203
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504089.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.61.3e-141694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g ++e     +  +  + W vk+  + +     +++GW eF+k+n+L+ gD++vF+++g++ef   v++f++
  XP_016504089.1 16 PGFKHA-LKIPKGFL-KYlKGHEHE---HAVLRRADKYWLVKV--NAY----RFKAGWAEFAKENDLQLGDILVFRYEGNMEF--EVMIFDS 94
                    456666.********.564666444...56777899*******..555....5**************************9999..8999886 PP

2B352.49.8e-17194275590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g l+lp +fa+  ++k  ++  l+++de+ r W++kl+ + +++r+ +++GW++F  +n+LkegD +vF+++ ++e+
  XP_016504089.1 194 TIKPYCLTYGYLYLPQQFANGLSNK--KG-NLIIRDERQRLWNLKLS-SDYKKRVRIGDGWRKFIADNRLKEGDRIVFEVVTDEET 275
                     578999999*********9555444..33.6999************6.6666799************************8876544 PP

3B347.63.1e-15349429589
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     +++++ l+ g l+lp +fa+  + +ke+  +l+++de+ r W++kl+ + +++r+ +++GW++F  +n+Lk gD ++F+++ ++e
  XP_016504089.1 349 TIKPYCLTYGYLYLPQPFANGLS-NKEC--DLIIRDERQRLWNLKLS-SDCKNRVRIGDGWRKFIVDNRLKKGDRIMFEVVTDEE 429
                     578999999*********94443.3344..8***************5.7788889************************876543 PP

4B3612e-19482571597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++++++ +++r+ +pk fa+e+g+++++  t++++d + rsWe++l y+ + g++++++ W++F+ an LkegD ++F+    +++++ +k++
  XP_016504089.1 482 TVKPHHISKCRMHVPKLFARENGLSNRQ-CTIVIRDYEQRSWEFRL-YSSCAGSTFIGGEWRKFCAANFLKEGDCIMFEIFA-KGEKPILKFY 571
                     56899999**************999765.6****************.9999999*************************544.7777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-21497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-20797IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.675795IPR003340B3 DNA binding domain
CDDcd100171.03E-15893No hitNo description
SMARTSM010193.0E-141095IPR003340B3 DNA binding domain
PfamPF023628.8E-111994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-18188280IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-17188280IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.437190286IPR003340B3 DNA binding domain
SMARTSM010193.5E-12191283IPR003340B3 DNA binding domain
PfamPF023621.8E-14194275IPR003340B3 DNA binding domain
CDDcd100172.71E-12195268No hitNo description
Gene3DG3DSA:2.40.330.104.5E-16343428IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-15343430IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.59345440IPR003340B3 DNA binding domain
SMARTSM010193.1E-8346437IPR003340B3 DNA binding domain
PfamPF023623.1E-13349429IPR003340B3 DNA binding domain
CDDcd100171.35E-11350423No hitNo description
Gene3DG3DSA:2.40.330.105.0E-19475569IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-18478570IPR015300DNA-binding pseudobarrel domain
CDDcd100177.17E-18478572No hitNo description
PROSITE profilePS5086312.464478576IPR003340B3 DNA binding domain
SMARTSM010192.6E-13479574IPR003340B3 DNA binding domain
PfamPF023629.5E-18482571IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MKVRPVKPHF FKPILPGFKH ALKIPKGFLK YLKGHEHEHA VLRRADKYWL VKVNAYRFKA  60
GWAEFAKEND LQLGDILVFR YEGNMEFEVM IFDSSHCNRE YAEYLQEEEA AATHTFGEAS  120
KNFEFEDTNN YASIPSGDQL YESSPSMSCY LIHSRNTDDV IEIPSPGIKL SDEDSSHAEA  180
ASDKHVGHSH FVCTIKPYCL TYGYLYLPQQ FANGLSNKKG NLIIRDERQR LWNLKLSSDY  240
KKRVRIGDGW RKFIADNRLK EGDRIVFEVV TDEETSIWKF HVVTNAKTPM RKFQGGHGLE  300
PWKQPLAEIP SPDNVVEIPS PGIKSSDEDS SHAETATDKH VGHSHFVCTI KPYCLTYGYL  360
YLPQPFANGL SNKECDLIIR DERQRLWNLK LSSDCKNRVR IGDGWRKFIV DNRLKKGDRI  420
MFEVVTDEES IWKFHAVTNA ETPMRKFQEK PEPNIMSSYK AFPDVEAAKD MPLSHPDHFI  480
STVKPHHISK CRMHVPKLFA RENGLSNRQC TIVIRDYEQR SWEFRLYSSC AGSTFIGGEW  540
RKFCAANFLK EGDCIMFEIF AKGEKPILKF YDLRANASLQ PEEWKPNLDA KRVST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767532.10.0PREDICTED: B3 domain-containing protein REM9-like isoform X2
RefseqXP_016504089.10.0PREDICTED: B3 domain-containing protein REM9-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.18e-41B3 family protein